SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001846169.1.94360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001846169.1.94360
Domain Number 1 Region: 78-219
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000000000143
Family Insect pheromone/odorant-binding proteins 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001846169.1.94360
Sequence length 242
Comment odorant-binding protein [Culex quinquefasciatus]; AA=GCF_000209185.1; RF=representative genome; TAX=7176; STAX=7176; NAME=Culex quinquefasciatus; strain=JHB; AL=Scaffold; RT=Major
Sequence
MLKFVICLAFLGLVAAYDFKDSFYNELLLEDLLDSEDVLTSADRFRRSPAMADPADDKCK
KQHHKHKCCNDANTDNLDKIRDLKKQCFSEQKTKERSARGMIDPVDMFNCEKMNKTKQDL
ICAIECVGRKKSILDKDGNLLEATKLVPFVKENFAADPWQEPLVEGFVDTCLKEVAEKMA
AKTEEFRCNPASSHFGYCMWRQTTMACPKEKQEQSKKCEKIREKLANNEPITMFGKHDFD
DN
Download sequence
Identical sequences B0WBT5
CPIJ004634|odorant-binding XP_001846169.1.94360 7176.CPIJ004634-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]