SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002038515.1.34323 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002038515.1.34323
Domain Number 1 Region: 139-238
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000301
Family Insect pheromone/odorant-binding proteins 0.0088
Further Details:      
 
Domain Number 2 Region: 20-126
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000222
Family Insect pheromone/odorant-binding proteins 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002038515.1.34323
Sequence length 242
Comment GM10854 [Drosophila sechellia]; AA=GCF_000005215.3; RF=representative genome; TAX=7238; STAX=7238; NAME=Drosophila sechellia; strain=Rob3c; AL=Scaffold; RT=Major
Sequence
MQMRSGILKALWLCLTFNEGLAILEHEGETINRCIQNYGGLTVENAERLGRFKEWSESYE
EIPCFTRCYLSEMFEFYNNLTGFNKDGIVGVFGRPVYEACRKKLELPFASGESSCKHAYE
GFHCITNMESHPFTVIDNMPNISPSAKNAMKDCLQDVHQDEWKSFDAFAYNPVNEPIPCF
TRCFVDKLHIFEEKTRLWKLEAMKRNLGIPAKGSRIRTCHRQRGKDRCATYYKQFTCYAM
AI
Download sequence
Identical sequences B4I4A9
XP_002038515.1.34323 FBpp0192331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]