SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002064401.1.14588 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002064401.1.14588
Domain Number 1 Region: 65-172
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000000641
Family Insect pheromone/odorant-binding proteins 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002064401.1.14588
Sequence length 185
Comment Odorant-binding protein 19c [Drosophila willistoni]; AA=GCF_000005925.1; RF=representative genome; TAX=7260; STAX=7260; NAME=Drosophila willistoni; strain=TSC#14030-0811.24; AL=Scaffold; RT=Major
Sequence
MMELEAQKKITLCLSLLCLFAFQVKAQTKIKPKTLDVRQPLDLTSLLGGGGRGSQPIWTL
MDQNLPQIQQMVDTSKSECLKQLKMPKQQRPLMRETRPTEQEKCLLECVLKKIKIMDGNN
KLSLPQVEKLTSLVTNNNKVAIALSCSLAQNCNRLITTKSPCEAAHQINQCISRQLENNR
VKLKW
Download sequence
Identical sequences B4MTE8
7260.FBpp0248861 FBpp0248861 XP_002064401.1.14588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]