SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002116579.1.101920 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002116579.1.101920
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Kringle-like 2.95e-23
Family Kringle modules 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002116579.1.101920
Sequence length 76
Comment hypothetical protein TRIADDRAFT_8692, partial [Trichoplax adhaerens]; AA=GCF_000150275.1; RF=representative genome; TAX=10228; STAX=10228; NAME=Trichoplax adhaerens; strain=Grell-BS-1999; AL=Scaffold; RT=Major
Sequence
CYTGTGEYFRGSVATSESGKACVQWDSVSSPYNTRNYPHSQLNSNQCRNPGANRNRPWCY
TSSKTAVWEYCSISAC
Download sequence
Identical sequences B3S8S0
XP_002116579.1.101920 jgi|Triad1|8692|gw1.16.133.1 10228.JGI8692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]