SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > NCBI 2017_08 genome > XP_002157812.1.79663

Domain assignment for XP_002157812.1.79663 from NCBI 2017_08 genome

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  XP_002157812.1.79663
Domain Number 1 Region: 1358-1416
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000366
Family TSP-1 type 1 repeat 0.00049
Further Details:      
 
Domain Number 2 Region: 2-49
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000719
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 3 Region: 765-819
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000746
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 409-463
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000785
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 5 Region: 1122-1174
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000889
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 54-105
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 1237-1293
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000209
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 8 Region: 587-640
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000379
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 9 Region: 1063-1117
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000432
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 10 Region: 1297-1354
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000432
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 11 Region: 1179-1232
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000523
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Domain Number 12 Region: 943-996
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000536
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Weak hits

Sequence:  XP_002157812.1.79663
Domain Number - Region: 707-761
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000105
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number - Region: 231-284
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00012
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number - Region: 174-227
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000157
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number - Region: 351-405
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000157
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number - Region: 111-170
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00017
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number - Region: 466-526
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000249
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number - Region: 530-582
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000288
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number - Region: 289-346
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000314
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number - Region: 886-938
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000392
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number - Region: 823-882
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000432
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number - Region: 645-702
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000785
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number - Region: 1001-1063
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00085
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002157812.1.79663
Sequence length 1578
Comment PREDICTED: SCO-spondin-like, partial [Hydra vulgaris]; AA=GCF_000004095.1; RF=representative genome; TAX=6087; STAX=6087; NAME=Hydra vulgaris; strain=105; AL=Scaffold; RT=Major
Sequence 
SFSEWSSWGACSASCNLDSVPPKTSRFRSCLPGLGSCIGSLSETQECNTNTPCQGIISSW
GAWSQCSATCQLTSTLPTQQRSRTCVGATLGGNCDGQSTVDSQTCSVGIYCPGTISDWSS
WGACSSICNNLVNIPFQTRSRSCIGYSTWDPNYTGCPGITKSDQQSCNVNVACSGSYGEW
SAWSSCSESCQSNPAATPFQTQTRPCLGATLGGGCAGPSSQTMACNTGVPCPGILSGWST
WGACSSSCQLDYTVPTQTSTRTCSGASLGGNCNGQALTQTKNCNAEVLCPGALSGWGSWS
ACSASCNTQVNGPYQYRSQTCIGASIWNPNYVGCNNVSLNDQQLCNQNVPCPGNYGAWSA
WGACSETCQSNTNVSPFQTQTRQCLGATLNGGCTGTSSQTQNCNTGVSCPGFISAWGAWG
ACSASCQLSFTSPSQTRNRQCVGATFNGNCNGAVLTDTQNCNEQVYCPGTISDWSSWGAC
SSICNNLVNIPFQTRSRSCIGYSTWDPNYTGCPGITKSDQQSCNVNVACSGSYGEWSAWS
SCSESCQSNPAATPFQTQTRPCLGATLGGGCAGPSSQTMACNSGVPCPGILSGWSTWGAC
SASCQLEYIVPTQTSTRTCSGASLGGNCNGQALTQTKNCNAEVLCPGTLSGWGSWSACSA
SCNTQVNGPYQYRSQSCIGASIWNPNYVGCNNVSLNDQQLCNQNVPCPGNYGAWSTWGAC
SESCQSNPNVSPIQTQTRQCIGATLNGGCPGTSSQTQSCNTGISCPGFISTWGAWGVCSA
SCQLSFTPPTQTRNRQCVGATFNGNCNGAVLTDTQNCNEQVYCQGTISDWSSWGACSSIC
NNLVTVPFQTRSRSCIGYSTWDPNYTGCPGITKSDQQSCNVNVACSGSYGAWSAWSSCSE
SCQSNPAATPFQTQTRPCLGATLGGGCAGPSSQTMACNSGVPCPGVLSGWSTWGACSASC
QLEYTVPTQTSTRTCSGASLGGNCNGQALTQTKNCNAEVICPGTLSGWGAWSVCSASCNT
QVNGPYQYRSQSCIGASTWNPNLVVCGGASLNDQQFCNQNVPCPGFYTAWSAWSSCSESC
QSNINNSPTQFHTRTCQNFTLNGGCVGVSSETQNCNSQVSCPGDLTQWSGFSACSQSCQI
GSVVPTMNRVRSCLNPTFGGNCQGQSLTDVQPCNAGVACPGQLTDWTSWSQCPATCQQTV
GQYNLQYRSRQCVNASLNGNCGGAVLNDQTPCVKDVPCPGILSQWSTWSSCSESCRSNLL
IAPSQTRTRTCTTATLGANCGGASLVESLSCNANVGCPGVWTSWGPFTDCSASCQSTGNI
VPTQSRQRFCVNNTLDGPCPSDNNGDKIQTVQCNVGVICPVRGTWSTWGAWSTCSASCDA
GIIQRSRACSVPYPIGAGDDCTGNTTQTLPCKLFDCPKSCAIAKRCNCSQVKQWSSVPTF
DQFQSRGLTHGAIETVLRYLSSYGDDTVDKACQACNTMMLTTLRSNVADQLSQAKAARAK
LELIKNDLRDVIYCNGIILNNAGLWSLYDLMFEHATMLDGVIIELNAIYLRFDAALTSCQ
SYGWIHQTFKTILRKCTF
Download sequence
Identical sequences gi|221112850|ref|XP_002157812.1| XP_002157812.1.79663 6085.XP_002157812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.