SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002317422.2.11743 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002317422.2.11743
Domain Number 1 Region: 18-95,123-150
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.4e-28
Family alpha-D-mannose-specific plant lectins 0.0025
Further Details:      
 
Weak hits

Sequence:  XP_002317422.2.11743
Domain Number - Region: 321-353
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00263
Family Pan module (APPLE domain) 0.068
Further Details:      
 
Domain Number - Region: 205-237
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00995
Family alpha-D-mannose-specific plant lectins 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002317422.2.11743
Sequence length 371
Comment hypothetical protein POPTR_0011s07370g, partial [Populus trichocarpa]; AA=GCF_000002775.3; RF=representative genome; TAX=3694; STAX=3694; NAME=Populus trichocarpa; AL=Chromosome; RT=Major
Sequence
PMPLSPPPRLSNTSIKSIMRWVWDANRGKPVHENATLSFKRDGNLILTDFDGTIAWQTGT
ANKGVVGLNLLPDGNLVLYDQRGKFIWQSFDHPTDTLLVGQNLRSSGPNRLVSRVSNMDG
SLGPYSFVMEQRYWALYYKVKNSPKPLLYYKSDEFGNGQGSLAHLNFYCKPEYEQAYAFE
VGFTYDMNNSPSSGTYILTRPKYNSTYSMLRLESDGNLKIYTYNENVDWGAWDLTFKLFD
RDSDLEISECKLPQRCGSLGVCEDNQCVACPRPQGFLGWSKSCAPPVLPPCKGGANVDYY
KVVGVEHFLNGYNEGEGPMKLVDCRNKCNNDCGCLGFFYKEESSKCLLAPVLGTLVGVSS
PSHVGFIKMSK
Download sequence
Identical sequences B9I1L7
XP_002317422.2.11743 POPTR_0011s07370.1|PACid:18230631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]