SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002606787.1.56174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002606787.1.56174
Domain Number 1 Region: 36-101
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000418
Family VWC domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002606787.1.56174
Sequence length 188
Comment hypothetical protein BRAFLDRAFT_82429 [Branchiostoma floridae]; AA=GCF_000003815.1; RF=representative genome; TAX=7739; STAX=7739; NAME=Branchiostoma floridae; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
MASPAVGVLCAVLLFVCTGDAARPYHQFEAVRTTPNFCPYHGVHYSDGEPVPGYSDDPCD
VCRCDVMSLGSITCHPGPGCNWLPCFDAVHVPNQCCPICPNGPNCQADVSGKHVIISVGQ
TLEVNGHNCRAHPSGQIIPVGVQVEVDGRQCYCSPEGAGLQVMCTATTTTTLPTTTMTPA
RPTTSTTT
Download sequence
Identical sequences C3YAP9
XP_002606787.1.56174 7739.JGI82429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]