SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002643748.1.8413 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002643748.1.8413
Domain Number 1 Region: 212-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000785
Family VWC domain 0.01
Further Details:      
 
Domain Number 2 Region: 343-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000336
Family EGF-type module 0.021
Further Details:      
 
Domain Number 3 Region: 372-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  XP_002643748.1.8413
Domain Number - Region: 275-339
Classification Level Classification E-value
Superfamily FnI-like domain 0.00136
Family VWC domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002643748.1.8413
Sequence length 430
Comment Hypothetical protein CBG01945 [Caenorhabditis briggsae]; AA=GCF_000004555.1; RF=representative genome; TAX=6238; STAX=6238; NAME=Caenorhabditis briggsae; strain=AF16; AL=Chromosome; RT=Major
Sequence
MWAHHLVIPLLLLITTGQCNIDKSPAMLSHYMNLLSFGESWLAATFDMSSNGTFFIAQNS
ERRLEIGFRNKTLYMVLPISKSKIETRNWMKRYVIDFDSVGKIGPILDLIVTFQHNHIHV
YDACDEIFAGFEPHLELSLVHAKTKIVENWEGAQPIDFGIGSGWPIGQKCRQGGAKKKYA
DSYSEEIEKSSQHTTFKDSDEIFFEQIVVSPPGFDGCKVNNELLMINETKILDCNICTCL
SRDDVVCRAIDCPAVTCKNPMIKKGGCCPVCGEQCFYENHKIANAHGEVFWPGDCYRCQC
WDTKVECSSEYATCEPPGCPDEDWVYNEKFNCCPRCRDFARFCAVNPCHKDASCTDSKRG
PKCSCNTGFQGNGTYCEDIDECAFSQDAREQLGGCLAGSICRNIPGSFKCDCMPGYQMIG
EHTCLPLIRV
Download sequence
Identical sequences A8WRM9
XP_002643748.1.8413 CBG01945 6238.CBG01945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]