SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002951391.1.37214 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002951391.1.37214
Domain Number - Region: 287-336
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.000173
Family VPS37 C-terminal domain-like 0.054
Further Details:      
 
Domain Number - Region: 50-91
Classification Level Classification E-value
Superfamily UBC-like 0.00315
Family UBC-related 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002951391.1.37214
Sequence length 348
Comment hypothetical protein VOLCADRAFT_105049 [Volvox carteri f. nagariensis]; AA=GCF_000143455.1; RF=representative genome; TAX=3068; STAX=3067; NAME=Volvox carteri f. nagariensis; strain=Eve; AL=Scaffold; RT=Major
Sequence
MQAAEQQQGLPRRRDYTDELLKAFPGSQVVNPEGSVVDIPFQLPSGRVTALRISLPAHFP
HERPVLCVLVPLQHRAVDPTGRLHVRGVDQWGARSSDHLLPQRGGIPAGVTPRDLVGVVR
EAFEVLLGEAAAKQGLLGESAATGSGGVDSADGSVGRKGRDGHVISLAGGMGGGQVVYGG
GSSGPTDPAALLEGMPAAKLLQLLEDEEELKKVAGSWLKDTPAARALEDVRRQNCTAAED
NLALARSIEEARGHVAIVRSGEYAAMRALFEGLYSRQEAVVAKMGTAKLLARLREEADKS
DAAADELLERFQEGSLPIEAFVEQYVAAREAFHITDLKRQAAEHSMLH
Download sequence
Identical sequences D8TY19
Vocar20003121m|PACid:23135894 XP_002951391.1.37214 jgi|Volca1|105049|estExt_fgenesh4_pg.C_230022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]