SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003074956.1.19543 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003074956.1.19543
Domain Number 1 Region: 122-179
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.39e-19
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00071
Further Details:      
 
Domain Number 2 Region: 3-43
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000188
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003074956.1.19543
Sequence length 179
Comment Tf2al transcription factor IIa large subunit 3, TFIIA3, putative (IC) [Ostreococcus tauri]; AA=GCF_000214015.2; RF=representative genome; TAX=70448; STAX=70448; NAME=Ostreococcus tauri; strain=RCC4221; AL=Chromosome; RT=Major
Sequence
MEIASQYKAVMREVIKNVAPDFIAEHVDFTILQQLEQSWERKLLQSGALSIFGADADTTL
ETSSKLIERGVNDNSSSPRTESQQTTQEETTGLEGNNSLKRKRESAGTQPVCQKDTESLS
SDSEDNTLEMEPPTSNLVLSQFEKVARTKNKWKCSFKDGIMLLNGSEYVFGKANAEFLW
Download sequence
Identical sequences Q01EM7
70448.Q01EM7 XP_003074956.1.19543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]