SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003114108.1.11157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003114108.1.11157
Domain Number 1 Region: 301-357
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 7.59e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00032
Further Details:      
 
Domain Number 2 Region: 5-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000011
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003114108.1.11157
Sequence length 357
Comment CRE-PQN-51 protein [Caenorhabditis remanei]; AA=GCF_000149515.1; RF=representative genome; TAX=31234; STAX=31234; NAME=Caenorhabditis remanei; strain=PB4641; AL=Scaffold; RT=Major
Sequence
MAHGNGIADIYKSVIADVISNMKEAFLDENIDVDVLSQLKKEWEDKVNSSGCVDLESNAP
PPAPRQQHVTPNPVRPNPIPNHRINPNVQQQQPQRSALAALHAAQMGDTPIRMAYTAQTV
QHPQQVRMFPQQFQGGMPFQPGQVFVVQQPGGQNLPMTIMPNQLQHRIVQQGQPQQIPQH
QQGNQLTHMNMNQMDGNGGSESDDEGCSEPLHVRQKKAKASMKVRGTGASKKEAMKVLGS
MLKEIQLDGGGGGMSDSSSEEEGEEDDDPLRRIADRMGNGEVEDGDQVAEEEPLNSEDDQ
SDDEDLTMLFDAENVVMCQFEKVNRARTKWKFQLKDGIMHIDKKDYCFQKCTGEAEW
Download sequence
Identical sequences E3LP02
CRE27199 31234.CRE27199 XP_003114108.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]