SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003220652.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003220652.1.98722
Domain Number 1 Region: 24-88
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000361
Family Growth factor receptor domain 0.0034
Further Details:      
 
Domain Number 2 Region: 85-160
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000272
Family VWC domain 0.094
Further Details:      
 
Domain Number 3 Region: 186-232
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000017
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003220652.1.98722
Sequence length 248
Comment PREDICTED: WNT1-inducible-signaling pathway protein 2 [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MKTQLLFISFLCLLSKVYTQRCQTPCYCPWLPPRCPPGSPLVLDGCGCCNVCARRLGEPC
NFLHVCDQSQGLICDYSAASMGRGGICNYEEGDDDNCEVNGKIYRDGEVFQPNCKVQCRC
SGGGFTCVPLCSEDVRLPTPDCPHPRRVEIPGKCCQEWICERQERRLLQDAMAAQRLPGT
VSMAFPGACEEWSTEWSACSTSCGVGMSVRVSNQNPYCRLETQRRLCILGPCQDLMGIHN
MRGRRNRL
Download sequence
Identical sequences XP_003220652.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]