SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003376176.1.5133 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_003376176.1.5133
Domain Number - Region: 304-341
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000392
Family Pan module (APPLE domain) 0.083
Further Details:      
 
Domain Number - Region: 37-84
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000432
Family Pan module (APPLE domain) 0.051
Further Details:      
 
Domain Number - Region: 218-262
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0053
Family Pan module (APPLE domain) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003376176.1.5133
Sequence length 410
Comment putative PAN domain protein [Trichinella spiralis]; AA=GCF_000181795.1; RF=representative genome; TAX=6334; STAX=6334; NAME=Trichinella spiralis; strain=ISS 195; AL=Scaffold; RT=Major
Sequence
MNTDQTLAFSEKVLIYLNATDSSCVVERKVFNLTHLFHLQFYLEESSSFQDCIVFCCKEE
TCKSVLYSNREGTCLLIENSFDDCHSKQFRLKNHPQLYAVHTCNQSASAIPDVMRTVQEE
ELLLLHSNDNLSSSSDEETLGASGYSPGASEILNGDVQRNEIYSVVVQYDAESEESADDN
DYDAAQCSLSIYQLFEECHINFLLKGEVVAGYKVIMHYSNVEHMELCAYYCRLNWDEDRC
GAVSFLISDKNCTLYKYTSDERAKINLKKNERFIEIVACYDDRSDERLENASPLSSWQII
AGSTNASSLQECMEMCRDNEVPDRCTAFNFAKTRSCFLFRKELGSSFSQARKGGSSMSLC
VCVCVRIACTGFYFLNTHFSYVKRKMPSYKTLMSKFSLNSHHLQDRISYL
Download sequence
Identical sequences E5S9D1
EFV58579 XP_003376176.1.5133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]