SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003463740.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003463740.1.53824
Domain Number 1 Region: 125-219
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 1.31e-35
Family VPS28 C-terminal domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 18-112
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 6.21e-34
Family VPS28 N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003463740.1.53824
Sequence length 221
Comment PREDICTED: vacuolar protein sorting-associated protein 28 homolog [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MFHGIPATPGMGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTV
SQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHS
Download sequence
Identical sequences A0A286XQV1
ENSCPOP00000005190 XP_003463740.1.53824 XP_004638928.1.9945 10141.ENSCPOP00000005190 ENSCPOP00000005190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]