SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003618227.1.50012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003618227.1.50012
Domain Number 1 Region: 51-169
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0000000000000183
Family LacY-like proton/sugar symporter 0.063
Further Details:      
 
Weak hits

Sequence:  XP_003618227.1.50012
Domain Number - Region: 199-235
Classification Level Classification E-value
Superfamily Plexin repeat 0.00345
Family Plexin repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003618227.1.50012
Sequence length 265
Comment MFS transporter [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence
MIFFFFRARVRSNSSRHKKFLLCKLGLATVLRKAILRKIYPAEEVDAEIQALQESVAMEL
KEAESSEKISMMTLLKTTSVRRGLYAGMGLQIFQQFVGINIVMYFSPTIVQLAGFASNQT
AMLLSLITAGLNTFGSLISIYFIDKTGRKKLALISLFGVVLSLVLLTVTFRQTETHSPMI
SEIETYRFNNTCPAFTPSRGGWDCTTCLKASPKCGFCASDSNKQPPKEDFVKCNLDVAMF
EVRHFLMAVTCWHEGSSPPQEVEAI
Download sequence
Identical sequences G7KI44
Medtr6g006260.1 XP_003618227.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]