SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003684856.1.77742 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003684856.1.77742
Domain Number 1 Region: 55-126
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 8.37e-19
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 2 Region: 6-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 1.52e-16
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003684856.1.77742
Sequence length 129
Comment hypothetical protein TPHA_0C02690 [Tetrapisispora phaffii CBS 4417]; AA=GCF_000236905.1; RF=representative genome; TAX=1071381; STAX=113608; NAME=Tetrapisispora phaffii CBS 4417; strain=type strain:CBS 4417; AL=Chromosome; RT=Major
Sequence
MSTPGYYELYRRSTVGSCLVDALDTLISDGRIEASLAMKVLESFDKVVSESLRENTQSKL
NVKGLLDTYGFCDDVWTFIIKDCKVTVESNKTATITNENGEQVTSTTDEQQTIQVDKLRI
VACNSKKGD
Download sequence
Identical sequences G8BRP6
XP_003684856.1.77742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]