SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004022405.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004022405.1.66739
Domain Number 1 Region: 93-179
Classification Level Classification E-value
Superfamily PUA domain-like 3.6e-18
Family PUA domain 0.004
Further Details:      
 
Weak hits

Sequence:  XP_004022405.1.66739
Domain Number - Region: 52-89
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0981
Family Hypothetical protein APE0525, N-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004022405.1.66739
Sequence length 182
Comment PREDICTED: malignant T-cell-amplified sequence 1 isoform X6 [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MGKGRFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHI
EILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSP
GAKLYLAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKT
YK
Download sequence
Identical sequences W5PV64
ENSOARP00000014346 XP_004022405.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]