SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004084039.1.28442 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004084039.1.28442
Domain Number 1 Region: 29-100
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000091
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number 2 Region: 92-164
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000455
Family Fibronectin type I module 0.023
Further Details:      
 
Domain Number 3 Region: 193-239
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000811
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004084039.1.28442
Sequence length 346
Comment connective tissue growth factor [Oryzias latipes]; AA=GCF_000313675.1; RF=representative genome; TAX=8090; STAX=8090; NAME=Oryzias latipes; strain=Hd-rR; AL=Chromosome; RT=Major
Sequence
MFANKEKVIWLPLLCLIYSYAAAGQECSGQCSCPSAPPRCPPGVSLVLDGCGCCRVCAKQ
MGELCTDKDVCDPHKNLFCDIGAPISRRIGVCTAREGASCVFGGTVYKSGETFQSSCKYQ
CTCMDGAMGCVPLCSMDIRLPSPDCPMPRRVKVPGKCCEEWECDSPYKDTLLGPALSAFR
EEETYGPDPNMMRENCLVQTTEWSACSKTCGLGISTRVTNDNHECRLEKQTRLCMVRPCE
SQMEQSIKKGKKCIRTPRVSKPMKFEISGCTTTKSYRPKFCGVCLDGRCCTPHRTTTLPM
EFKCPDGQVMKKHMMFIKSCACHYNCPGENDIFEAMYYKKMTGDTV
Download sequence
Identical sequences XP_004084039.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]