SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006093014.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_006093014.1.53796
Domain Number - Region: 45-117
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0942
Family Insect pheromone/odorant-binding proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006093014.1.53796
Sequence length 138
Comment PREDICTED: protein FAM136A [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MADVQQLRVQEAVDTLVKSLERENIRKMQGLMFRCSADCCEDSQASMQQVHQCIERCHAP
LAQAQALVTSELEKFQDRLARCTMHCNDKAKDSIDAGNKERQVKRQLESCVTKCVDDHMN
LIPTMTKKMKESLSSIQK
Download sequence
Identical sequences G1NXX8
ENSMLUP00000002247 XP_006093014.1.53796 ENSMLUP00000002247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]