SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007482265.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007482265.1.35504
Domain Number 1 Region: 152-266
Classification Level Classification E-value
Superfamily FKBP-like 4.52e-38
Family FKBP immunophilin/proline isomerase 0.00033
Further Details:      
 
Domain Number 2 Region: 40-160
Classification Level Classification E-value
Superfamily FKBP-like 1.3e-37
Family FKBP immunophilin/proline isomerase 0.00015
Further Details:      
 
Domain Number 3 Region: 275-370
Classification Level Classification E-value
Superfamily FKBP-like 2.75e-31
Family FKBP immunophilin/proline isomerase 0.00052
Further Details:      
 
Domain Number 4 Region: 387-454
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000792
Family Calmodulin-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007482265.1.35504
Sequence length 468
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP10 isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MSPWGSLSRTLPLFPILLLLLLQASGRALSRASPGGGPLEDVVIERYHVPRACPREVQMG
DFIRYHYNGTFEDGKKFDSSYDRGATVAGVVGVGRLITGMDRGLMGMCVNERRRLVVPPH
LGYGSIGVAGLIPPDSTLYFDVVLLDVWNKEDSVQVDTLLRPPFCPRMVQDSDFVRYHYN
GTLLDGTAFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGVCIGELRRITIPPHLAYGENGA
GDKIPGSAVLIFDVHVIDFHNPSDTVESQTLSRPSEGCNETSKLGDFIRYHYNCSLLDGT
KLFSSHDYGEPQEVTLGTNKVIEGLNTGLQGMCVGEKRQLIIPPHLGHGENGARGVPGSA
VLQFEVELVSREDGLPEGYLFVWHGDPPTNLYENMDLNKDGEIPPEEFSAFIKAQVAEGK
GKLMPGQDPEKTIGDMFQNQDRNQDGKITMEELKLKSDEDQERVHEEL
Download sequence
Identical sequences XP_007482265.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]