SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007497242.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007497242.1.35504
Domain Number 1 Region: 28-184
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-30
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 2 Region: 203-282
Classification Level Classification E-value
Superfamily GAS2 domain-like 5.75e-30
Family GAS2 domain 0.00000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007497242.1.35504
Sequence length 315
Comment PREDICTED: growth arrest-specific protein 2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MMCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGNEITAETFME
KLDNGALLCQLAETVQEKFKDNTDANKPVKCLPMRKIPCKASAPSGSFFARDNTANFLSW
CRDVGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETL
SAPSPSPSPSSTKSSGKKSTGNLLDDAVKHISEDPPCKCPNKFCVERLSQGRYRVGEKIL
FIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDN
YLVVSAHYKAKKEIK
Download sequence
Identical sequences F7GJZ4
ENSMODP00000011634 XP_007497241.1.35504 XP_007497242.1.35504 XP_007497243.1.35504 ENSMODP00000011634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]