SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007588706.1.99346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007588706.1.99346
Domain Number 1 Region: 56-96
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.0000000016
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.002
Further Details:      
 
Domain Number 2 Region: 8-51
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000575
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007588706.1.99346
Sequence length 126
Comment putative transcription initiation factor iia small chain protein [Neofusicoccum parvum UCRNP2]; AA=GCF_000385595.1; RF=representative genome; TAX=1287680; STAX=310453; NAME=Neofusicoccum parvum UCRNP2; AL=Scaffold; RT=Major
Sequence
MASQEPDKHYRRTSIGLALIAALDELPAILPQLAEKIRQHFDREMVNALRSQRVIRKRMN
FKARCHTYRFCDDRWYFMLKDVKVKTDSGRSIKADWVTIDAVSTGLEEERRMLKELRAGS
KSKKKR
Download sequence
Identical sequences R1E8T2
XP_007588706.1.99346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]