SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007945783.1.48129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007945783.1.48129
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.57e-19
Family Ribosomal protein L39e 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007945783.1.48129
Sequence length 51
Comment PREDICTED: 60S ribosomal protein L39-like [Orycteropus afer afer]; AA=GCF_000298275.1; RF=representative genome; TAX=1230840; STAX=9818; NAME=Orycteropus afer afer; AL=Scaffold; RT=Major
Sequence
MCSHKTFRIKRFLAKKQKQNWPIPQWIRMNTGNKIRYNSKRRHWRRTKLGL
Download sequence
Identical sequences XP_007945783.1.48129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]