SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008543435.1.5247 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008543435.1.5247
Domain Number 1 Region: 117-238
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 2.09e-30
Family Insect pheromone/odorant-binding proteins 0.00075
Further Details:      
 
Domain Number 2 Region: 1-116
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 6.93e-28
Family Insect pheromone/odorant-binding proteins 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008543435.1.5247
Sequence length 238
Comment PREDICTED: uncharacterized protein LOC103568376 [Microplitis demolitor]; AA=GCF_000572035.2; RF=representative genome; TAX=69319; STAX=69319; NAME=Microplitis demolitor; strain=Queensland-Clemson subculture; AL=Scaffold; RT=Major
Sequence
MTVEQIKNMMKPLGKTCVSKVGLSPELQEAHRNGQFPEEKSFMCYIHCLARMTKVFDKNN
QIDLEGTFKQAKLVLPEDLIDGSINAYKTCYPSATSEEPCEKAYQFGKCYYETDAKAMTI
DQIKNMMKPLGKTCVSKVGLSPELQEQHRNREFPEDRTFMCYMHCMAKMTKVFDKNNNFN
LEGTFKQTKIVLPEEMIEDSLNAYTTCYPKATSDDPCEKAYQFGKCYCETDAKSYFYP
Download sequence
Identical sequences XP_008543435.1.5247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]