SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008929113.1.96775 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008929113.1.96775
Domain Number 1 Region: 5-114
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.47e-28
Family Insect phospholipase A2 0.0029
Further Details:      
 
Domain Number 2 Region: 120-188
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.000000161
Family Insect phospholipase A2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_008929113.1.96775
Sequence length 268
Comment PREDICTED: group 3 secretory phospholipase A2 [Manacus vitellinus]; AA=GCF_000692015.1; RF=na; TAX=328815; STAX=328815; NAME=Manacus vitellinus; AL=Scaffold; RT=Major
Sequence
MYQSGLFRGPDRCCREHDQCWAQITALQFNYGIRNYRLHTVSHCDCDARFRHCLLAINDT
VSNIIGVTFFNLLEVPCFVLEESEECIQWHWWGGCKRYGVVPLARMVQQSQHRPGWVCRC
YKHLGKCEHQIAPHEVRYQLHNVNSQTLLHCNCTRRLERCLRRVRNCSNMEVAVLANHIA
TDCFVLEQLVACSPGRGSQDSCTTVTRAVLLPAKRLKKTLRRWGPLHVSSKTKHPDWKTQ
ARGGILCEQCQHLAMEQGLGAQPHTVPR
Download sequence
Identical sequences XP_008929113.1.96775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]