SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009049607.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009049607.1.39240
Domain Number 1 Region: 52-103
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 9.42e-20
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00021
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 1.1e-17
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009049607.1.39240
Sequence length 109
Comment hypothetical protein LOTGIDRAFT_238741 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MSYQLYRNTTLGHTLQESLDELIRHGQISPNLALQVLLQFDKAINNALANRVKSKISFKG
KLNTYRFCDNVWTFVLNNVEFRELPVQELTTVDKVKIVACDGKGADPKG
Download sequence
Identical sequences V4AXB3
jgi|Lotgi1|238741|estExt_fgenesh2_pg.C_sca_1650007 XP_009049607.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]