SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010089945.1.32101 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010089945.1.32101
Domain Number 1 Region: 6-53
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 2.48e-21
Family Ribosomal protein L39e 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010089945.1.32101
Sequence length 54
Comment 60S ribosomal protein L39 [Morus notabilis]; AA=GCF_000414095.1; RF=representative genome; TAX=981085; STAX=981085; NAME=Morus notabilis; AL=Scaffold; RT=Major
Sequence
MNSQPSHKTFRIKKKLAKKMRQNRPIPHWIRLRTDNTIRYNAKRRHWRRTKLGF
Download sequence
Identical sequences W9R5P2
XP_010089945.1.32101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]