SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011190069.1.96551 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011190069.1.96551
Domain Number 1 Region: 30-91
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000074
Family Insect pheromone/odorant-binding proteins 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011190069.1.96551
Sequence length 165
Comment PREDICTED: uncharacterized protein LOC105216979 [Bactrocera cucurbitae]; AA=GCF_000806345.1; RF=representative genome; TAX=28588; STAX=28588; NAME=Zeugodacus cucurbitae; strain=USDA-PBARC White Pupae T1; AL=Scaffold; RT=Major
Sequence
MCCSVPDLSTEELMKQCAKFDHSQYQHYPPHMHGLHHHPCLIECIFNKTEVISDNGEPDV
DKFSALLDTTVKDNEEMAAIMEEAFETCAEKMSDLKAMITEEMSKNPEYAEKITNHSMQS
GCSPYGAILMKCVNMETFEKCPASAWNDSTECNTVRDFIKECEHI
Download sequence
Identical sequences XP_011190069.1.96551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]