SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011190070.1.96551 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011190070.1.96551
Domain Number 1 Region: 53-142
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000458
Family Insect pheromone/odorant-binding proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011190070.1.96551
Sequence length 216
Comment PREDICTED: uncharacterized protein LOC105216980 [Bactrocera cucurbitae]; AA=GCF_000806345.1; RF=representative genome; TAX=28588; STAX=28588; NAME=Zeugodacus cucurbitae; strain=USDA-PBARC White Pupae T1; AL=Scaffold; RT=Major
Sequence
MSQASNMRTNFGYFVVICVLGCYASAEDKSVDCTKPPPFVPLHMCCHVPDLSTIALKEQC
AEFAKPSTPTPKVDHSQHHPTHMHELHLHPCLIECIFNKTEVFGENGQPDVDKFSALLDT
TVKDNKELAAIMEESFETCAEKLSDLKAKMAEEKSKNPKYAEKMATQNMQMGCSPFGAIL
MDCVNMETFKNCPASAWNDSTECNAVRDFIKECEYV
Download sequence
Identical sequences XP_011190070.1.96551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]