SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011267977.1.72520 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011267977.1.72520
Domain Number 1 Region: 4-127
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000811
Family Insect pheromone/odorant-binding proteins 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011267977.1.72520
Sequence length 133
Comment PREDICTED: pheromone-binding protein Gp-9 [Camponotus floridanus]; AA=GCF_000147175.1; RF=representative genome; TAX=104421; STAX=104421; NAME=Camponotus floridanus; AL=Scaffold; RT=Major
Sequence
MKIIVLCVCVLGFALSDLVGNKTIRQSAEEAEGALREKLETCMTENNVTFDAWSEAVQIL
INVHKKPENVEKSRKLGCILACYLKKQDLMEDSKNEQKAYAIIDIISIGHPRNAEAQRIA
RNCIKEGENKQAG
Download sequence
Identical sequences XP_011267977.1.72520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]