SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011332458.1.87679 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011332458.1.87679
Domain Number 1 Region: 26-137
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.96e-27
Family Insect pheromone/odorant-binding proteins 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011332458.1.87679
Sequence length 146
Comment PREDICTED: general odorant-binding protein 69a isoform X1 [Ooceraea biroi]; AA=GCF_000611835.1; RF=representative genome; TAX=2015173; STAX=2015173; NAME=Ooceraea biroi; AL=Scaffold; RT=Major
Sequence
MRLLAVAVGFLLQAWIVSCGTRPSFVSDQMIATAASVVNACQTQTGVATADIEAVRNGQW
PETRQLKCYMYCLWEQFGLVDDKRELSLNGMLTFFQRIPAYRAEVEKAISECKGIGNYLA
KGDDCEYAYTFNKCYAGLSPRTYYLF
Download sequence
Identical sequences A0A026WRQ9
XP_011332458.1.87679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]