SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011557110.1.9062 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011557110.1.9062
Domain Number 1 Region: 24-147
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.96e-22
Family Insect pheromone/odorant-binding proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011557110.1.9062
Sequence length 149
Comment PREDICTED: uncharacterized protein LOC105387986 [Plutella xylostella]; AA=GCF_000330985.1; RF=representative genome; TAX=51655; STAX=51655; NAME=Plutella xylostella; strain=DBM-FZ-S; AL=Scaffold; RT=Major
Sequence
MIKTCLFISVCAMVNVLLVQARTEKEIREEFIQLGMECAKQHQVTPEEIQLMHQHVIPDG
SGARCLVACVFKKKDLINDKGMLDIDAAHSMADKEHLDDPTMIENSKKLFDLCKSVNDET
VSDGEKGCDRAALLSKCLIANYSKFGFKI
Download sequence
Identical sequences XP_011557110.1.9062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]