SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011684328.1.89273 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011684328.1.89273
Domain Number 1 Region: 5-114
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000563
Family Insect pheromone/odorant-binding proteins 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011684328.1.89273
Sequence length 126
Comment PREDICTED: pheromone-binding protein Gp-9-like isoform X1 [Wasmannia auropunctata]; AA=GCF_000956235.1; RF=representative genome; TAX=64793; STAX=64793; NAME=Wasmannia auropunctata; AL=Scaffold; RT=Major
Sequence
MSKTDVQICFNKTNVNLTDLMMMDQLVNDEVQTASINNSALKVSCLFACLLQKKGLMVGT
NINVERMKEEMDNKSHLNTKDIAVRNNILDICIDRVKSKTNECDVILKLVLCVIAETKRY
HKSIIR
Download sequence
Identical sequences XP_011684328.1.89273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]