SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011748594.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011748594.1.29376
Domain Number 1 Region: 27-183
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.81e-31
Family Calponin-homology domain, CH-domain 0.0027
Further Details:      
 
Domain Number 2 Region: 201-280
Classification Level Classification E-value
Superfamily GAS2 domain-like 4.84e-30
Family GAS2 domain 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011748594.1.29376
Sequence length 313
Comment PREDICTED: growth arrest-specific protein 2 isoform X1 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEK
LDNGALLCQLAETVQEKFKESMDVNKPTKNLPLKKIPCKANAPSGSFFARDNTANFLSWC
RDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLS
APSPSPSPSSKSSGKKSTGNLLDDAVKRISEDPPCKCPNKFCVERLSQGRYRVGEKILFI
RMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYL
VVSANYKAKKEIK
Download sequence
Identical sequences A0A2K5XYQ9 H9EQZ6
ENSMMUP00000027401 NP_001244553.1.72884 XP_008002252.1.81039 XP_008002262.1.81039 XP_008002269.1.81039 XP_008002276.1.81039 XP_008002285.1.81039 XP_008002292.1.81039 XP_011748594.1.29376 XP_011748595.1.29376 XP_011748596.1.29376 XP_011748597.1.29376 XP_011748598.1.29376 XP_011748599.1.29376 XP_011826710.1.47321 XP_011826711.1.47321 XP_011931335.1.92194 XP_011931336.1.92194 XP_014970105.1.72884 ENSMMUP00000027401 9544.ENSMMUP00000027401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]