SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011862285.1.68811 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011862285.1.68811
Domain Number 1 Region: 94-220
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 4.96e-33
Family Insect phospholipase A2 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011862285.1.68811
Sequence length 231
Comment PREDICTED: acidic phospholipase A2 PA4 [Vollenhovia emeryi]; AA=GCF_000949405.1; RF=representative genome; TAX=411798; STAX=411798; NAME=Vollenhovia emeryi; AL=Scaffold; RT=Major
Sequence
MLAVLLGVLSILWAERTEASVLVADTTMSRMVELNADAPFCALYNDRGVIQKMVLGADPR
KVRQISSNLVADLEETCKASRNKGKNQAPGGGLIYPGTKWCGPGNVADSYDDVGQHSVED
TCCREHDHCPFTIAPQQCIHGICNNSPFTRSHCDCDAKFRRCLQNLNTEVANTLGALFFN
VIQVICFKERRPCSQWQRNGYAEAVSDRLCSQYKFRPSDKYVPMMPLNMNK
Download sequence
Identical sequences XP_011862285.1.68811 XP_011862286.1.68811 XP_011862287.1.68811 XP_011862288.1.68811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]