SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011875157.1.68811 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011875157.1.68811
Domain Number 1 Region: 145-247
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000000327
Family Insect pheromone/odorant-binding proteins 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011875157.1.68811
Sequence length 249
Comment PREDICTED: general odorant-binding protein 71 isoform X2 [Vollenhovia emeryi]; AA=GCF_000949405.1; RF=representative genome; TAX=411798; STAX=411798; NAME=Vollenhovia emeryi; AL=Scaffold; RT=Major
Sequence
METRVILVVLCSLCLSLESANSLKCRTGVQQANTQYEKIMQICKKRSTTDDDDYNDSSSN
EDEDNDDSSSIDLFGTKFYMSGGNKFSNRQSWKDLNENRNRGNDQKNGNDRRYSVNHTNG
NWRNAQHPSRGNSNRDFNNFDGAGRPSYDQMYNGNSDNYKQQEQACITQCFFNELNMVDQ
RGFPEQVLIIQFLTRNVHNPELQDFIEEAVIECFHYLDSDMGQNKCYFSENLLTCLIDKG
KERCEDWDN
Download sequence
Identical sequences XP_011875157.1.68811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]