SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012059205.1.45171 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012059205.1.45171
Domain Number 1 Region: 34-147
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 8.11e-27
Family Insect pheromone/odorant-binding proteins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012059205.1.45171
Sequence length 148
Comment PREDICTED: uncharacterized protein LOC105622389 [Atta cephalotes]; AA=GCF_000143395.1; RF=representative genome; TAX=12957; STAX=12957; NAME=Atta cephalotes; AL=Scaffold; RT=Major
Sequence
MAKKSLVLICVSIILTQLVIVSCNEEDIDWTTVHDELRKMAGGLRKKCTGETGATNEMLE
EAELGEFPTKDKTLGCYFKCVMEKGGAMKKDGKINYKILSKLMPPAYKHIGMEMLDQCRN
IEGTDKCVIAMNFNKCMFNANPVAYFVI
Download sequence
Identical sequences A0A158NNU7
XP_012059205.1.45171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]