SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012149309.1.71094 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012149309.1.71094
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.09e-27
Family Insect pheromone/odorant-binding proteins 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012149309.1.71094
Sequence length 162
Comment PREDICTED: general odorant-binding protein 69a-like isoform X2 [Megachile rotundata]; AA=GCF_000220905.1; RF=representative genome; TAX=143995; STAX=143995; NAME=Megachile rotundata; AL=Scaffold; RT=Major
Sequence
MIATAASVVNACQTQTGVATVDIEAVRNGEWPERRQLKCYMYCLWEQFGLVDDKRELSLN
GMLTFFQRIPAFRAEVQKAISECKGIAKGDNCEYAYTFNKCYAKASPRVSIFVFLRRIMV
PMSTENSLLILDLLSILTCHRDCSEQRRNETKEKTVLEKMSR
Download sequence
Identical sequences XP_012149309.1.71094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]