SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012238936.1.29386 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012238936.1.29386
Domain Number 1 Region: 97-223
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.47e-34
Family Insect phospholipase A2 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012238936.1.29386
Sequence length 233
Comment PREDICTED: acidic phospholipase A2 PA4 isoform X1 [Bombus impatiens]; AA=GCF_000188095.1; RF=representative genome; TAX=132113; STAX=132113; NAME=Bombus impatiens; AL=Scaffold; RT=Major
Sequence
MKQMLAVFLLLIPTLWGDETEANVLVADTTMSRMVELHAGAPFCSLYTDRGVIQKMILGA
DPKKVRQMSANLVADLEETCKASREKGKNQPPGSGLIYPGTKWCGPGTLAKSYDDLGHHA
SEDACCREHDHCPITISPKECINGICNHSPFTRSHCDCDAKFRRCLQNLNSEVANTLGAL
FFNVIQVTCFKERRPCSQWQRNGYAESESNRLCSQYKFRPSDKYVPLMPLNVN
Download sequence
Identical sequences XP_012238936.1.29386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]