SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013097535.1.53170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013097535.1.53170
Domain Number 1 Region: 196-271
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000301
Family Insect pheromone/odorant-binding proteins 0.011
Further Details:      
 
Domain Number 2 Region: 50-99
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000615
Family Insect pheromone/odorant-binding proteins 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013097535.1.53170
Sequence length 288
Comment PREDICTED: uncharacterized protein LOC106080644 isoform X1 [Stomoxys calcitrans]; AA=GCF_001015335.1; RF=representative genome; TAX=35570; STAX=35570; NAME=Stomoxys calcitrans; breed=8C7A2A5H3J4; AL=Scaffold; RT=Major
Sequence
MGVSEGFNCRVLLSLMSILVCFYAVKGGVGIQNGLNQEIILPESLIRFASQRCMEQYPQA
DAFNWTDTADTHCYSQCLLHKMGLMNLRTRGLDNIKLMDIWDDIEEAFDEERCVDNINIG
QPLSGKCVDSYSKLMELRTHCLELFEYTFMGNSSWKSKDPSKSIGQSASEFCDSFDEDGD
VATESTQSLEITFQSLYKNKLVCLYQNYHFIDAYGRVDDIELLRSYEEAQMDVTEAKEFV
KYCSHKANSKFKRDNLSDAVFELQYCLKQKSPEFEMISQLRNERSRSY
Download sequence
Identical sequences A0A1I8PD45
XP_013097535.1.53170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]