SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014050318.1.97760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014050318.1.97760
Domain Number 1 Region: 64-172
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 2.15e-16
Family Insect phospholipase A2 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014050318.1.97760
Sequence length 194
Comment PREDICTED: group XIIA secretory phospholipase A2-like [Salmo salar]; AA=GCF_000233375.1; RF=representative genome; TAX=8030; STAX=8030; NAME=Salmo salar; breed=double haploid; AL=Chromosome; RT=Major
Sequence
MHHNSCIPFFLVGLLSFYVFLSCVSSCSKEPKTPDWRMTLKTIRNGIHNIDKYLNVALDL
FGGQDGLCHYECSDGYKPEPRPGYKPTPPNGCGSPLFGFQFDIGIPSLTKCCNQHDRCYD
TCNRDKHDCDDEFQECLETICRRLQKMLGLAQSVQVCENTVTLLFEAVMHMGCKPYMDSQ
RDSCICKFEVKRDL
Download sequence
Identical sequences B5XE92
XP_014050318.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]