SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014772562.1.24776 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014772562.1.24776
Domain Number 1 Region: 250-307
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.73e-20
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00012
Further Details:      
 
Domain Number 2 Region: 5-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000241
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014772562.1.24776
Sequence length 307
Comment PREDICTED: transcription initiation factor IIA subunit 1-like [Octopus bimaculoides]; AA=GCF_001194135.1; RF=representative genome; TAX=37653; STAX=37653; NAME=Octopus bimaculoides; AL=Scaffold; RT=Major
Sequence
MAAPNQVPKLYKTVVDDVITSVREAFLDEGVDEQILQELRQSWENKMIQSKAVGSVTEEH
VFSGPYAVATQSQTIAGKQKVMSNQLTQAISVPIQITRPAGTTELSTPAQTAAMALTTGL
FQQQLAAGISLQPSANNHFITVTNIPQQAVQSSPQVATATITVPNANTLVHNQVHTTATV
SAPSTQVLHPTVNASTPTSIIQFDGAADTSSEDEDDYENDENEDEEDEAANEEEVETGGV
EEEPLNSEDDVSDGDVTDLFDTDNVVVCQYEKIHRNKNKWKFQLKDGIMNLNGKDSVFQK
GVGDAEW
Download sequence
Identical sequences A0A0L8HG75
Ocbimv22015153m.p XP_014772562.1.24776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]