SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015198915.1.81211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015198915.1.81211
Domain Number 1 Region: 52-101
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.18e-18
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000869
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 1.2e-17
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015198915.1.81211
Sequence length 147
Comment PREDICTED: transcription initiation factor IIA subunit 2 [Lepisosteus oculatus]; AA=GCF_000242695.1; RF=representative genome; TAX=7918; STAX=7918; NAME=Lepisosteus oculatus; AL=Chromosome; RT=Major
Sequence
MAYQLYRNTTLGNSLQESLDELIQTQQITPQLALQVLLQFDKAINTALANRVRNRVNFRG
SLNTYRFCDNVWTFVLNDVEFREVTDLVKVDKVKIVACDGKSKCRLWPILLILFLFLHGC
TIMYEMFFGDSVWLLCIKLKGVVSRFQ
Download sequence
Identical sequences XP_015198915.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]