SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015309711.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015309711.1.63531
Domain Number 1 Region: 414-564
Classification Level Classification E-value
Superfamily TRAF domain-like 2.62e-50
Family MATH domain 0.0000000357
Further Details:      
 
Domain Number 2 Region: 364-413
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 1.57e-20
Family Trimerization domain of TRAF 0.0000865
Further Details:      
 
Domain Number 3 Region: 112-211
Classification Level Classification E-value
Superfamily TRAF domain-like 2.94e-16
Family SIAH, seven in absentia homolog 0.016
Further Details:      
 
Domain Number 4 Region: 42-99
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000141
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 5 Region: 212-253
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000163
Family SIAH, seven in absentia homolog 0.011
Further Details:      
 
Weak hits

Sequence:  XP_015309711.1.63531
Domain Number - Region: 270-410
Classification Level Classification E-value
Superfamily Tropomyosin 0.00281
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015309711.1.63531
Sequence length 568
Comment PREDICTED: TNF receptor-associated factor 3 isoform X3 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MESSKKMDSPGPLQTNPPLKLHTDRSAGTPIFAPEQGGYKEKFVKTVEDKYKCEKCRLVL
CSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNE
SRGCAEQLTLGHLLVHLKNDCHFEELPCVRADCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
Download sequence
Identical sequences A0A0D9RCP3 A0A2K5VRW6 A0A2K5YPS4 A0A2K6AQY5 G7MWG3
ENSPANP00000013259 XP_005562314.1.63531 XP_005562315.1.63531 XP_007986106.1.81039 XP_007986107.1.81039 XP_007986108.1.81039 XP_007986109.1.81039 XP_007986110.1.81039 XP_011715241.1.29376 XP_011715242.1.29376 XP_011715243.1.29376 XP_011846977.1.47321 XP_015309711.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]