SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016128747.1.42290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016128747.1.42290
Domain Number 1 Region: 52-101
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 6.02e-19
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000869
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 6.02e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016128747.1.42290
Sequence length 109
Comment PREDICTED: transcription initiation factor IIA subunit 2 [Sinocyclocheilus grahami]; AA=GCF_001515645.1; RF=representative genome; TAX=75366; STAX=75366; NAME=Sinocyclocheilus grahami; AL=Scaffold; RT=Major
Sequence
MAYQLYRNTTLGNSLQESLDELIQTQQITPQLALQVLLQFDKAINTALANRVRNRVNFRG
SLNTYRFCDNVWTFVLNDVEFREVTDLVKVDKVKIVACDGKNTGSNAAE
Download sequence
Identical sequences Q503H9
NP_001018441.1.45394 XP_016128747.1.42290 XP_016357496.1.79318 XP_016357497.1.79318 XP_016409648.1.44103 XP_016421421.1.44103 XP_018958521.1.5815 XP_018958522.1.5815 ENSDARP00000070238 ENSDARP00000070238 7955.ENSDARP00000070238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]