SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017232283.1.63501 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017232283.1.63501
Domain Number 1 Region: 52-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 3.4e-20
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00068
Further Details:      
 
Domain Number 2 Region: 4-54
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 3.14e-17
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017232283.1.63501
Sequence length 106
Comment PREDICTED: transcription initiation factor IIA subunit 2 [Daucus carota subsp. sativus]; AA=GCF_001625215.1; RF=representative genome; TAX=79200; STAX=4039; NAME=Daucus carota subsp. sativus; cultivar=DH1; AL=Chromosome; RT=Major
Sequence
MATFELYRRSTIGMCLTETLDEMVDNGVLSPELAIQVLVQFDKSMTEALESQVKSKVSIK
GHLHTYRFCDNVWTFILQDAVFKNEDSQETVGRVKIVACDSKLLTQ
Download sequence
Identical sequences A0A161Y7X4
XP_017232283.1.63501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]