SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017491657.1.95384 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017491657.1.95384
Domain Number 1 Region: 52-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.18e-18
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0002
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 1.94e-16
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017491657.1.95384
Sequence length 113
Comment PREDICTED: transcription initiation factor IIA subunit 2-like [Rhagoletis zephyria]; AA=GCF_001687245.1; RF=representative genome; TAX=28612; STAX=28612; NAME=Rhagoletis zephyria; AL=Scaffold; RT=Major
Sequence
MAYQLYRNTTIGHTLQESLDEFVSSGQISNGLSQKVMLQFDKAINNALANRVKSRLTFKA
GHLKTYRFCDNVWTFVLKDVEFREVQELIKIDKVKIVACDGKSSQQQKDAERD
Download sequence
Identical sequences XP_017491657.1.95384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]