SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018313749.1.62676 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018313749.1.62676
Domain Number 1 Region: 50-145
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 3.54e-22
Family Insect phospholipase A2 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018313749.1.62676
Sequence length 241
Comment PREDICTED: phospholipase A2-like [Trachymyrmex zeteki]; AA=GCF_001594055.1; RF=representative genome; TAX=64791; STAX=64791; NAME=Trachymyrmex zeteki; AL=Scaffold; RT=Major
Sequence
MRGICVISLISFYMLALFVNNNGITEGHSVKDYLRGLYALKQVKNLRHGILPGTLWCGLG
DIARKNSDLGMYTEMDECCRTHDSCEDYIEPKSARYGLYNEYICRGSLCECELQFHNCLT
RIRGLYPYAVRRIYFSACKQCFRTFYDPQECINEGLDIIKEIDRKGRRVFCAKFNRNLKW
DRRHNITTPESIPATELSIWDNDKSIQFASRFYPGKDKEYSNDKDDITYDENYILFEDNY
N
Download sequence
Identical sequences XP_018313749.1.62676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]