SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018437250.1.40639 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018437250.1.40639
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.15e-21
Family Ribosomal protein L39e 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018437250.1.40639
Sequence length 51
Comment PREDICTED: 60S ribosomal protein L39-1 [Raphanus sativus]; AA=GCF_000801105.1; RF=representative genome; TAX=3726; STAX=3726; NAME=Raphanus sativus; cultivar=WK10039; AL=Scaffold; RT=Major
Sequence
MPSHKSFMIKKKLAKKMRQNRPIPHWIRLRTDNTIRYNAKRRHWRRTKLGF
Download sequence
Identical sequences A0A0D3BLW0 D7LK63
jgi|Araly1|901138|scaffold_400639.1 jgi|Araly1|913258|scaffold_701000.1 59689.scaffold_400639.1 59689.scaffold_701000.1 XP_002869300.1.15461 XP_002878833.1.15461 XP_009108896.1.100322 XP_009117075.1.100322 XP_009126494.1.100322 XP_009140630.1.100322 XP_013603092.1.26608 XP_013626886.1.26608 XP_013634411.1.26608 XP_013660037.1.73403 XP_013667693.1.73403 XP_013681436.1.73403 XP_013681556.1.73403 XP_013685194.1.73403 XP_013747051.1.73403 XP_013747057.1.73403 XP_018437250.1.40639 XP_018449463.1.40639 XP_018461718.1.40639 XP_018469193.1.40639 XP_018480795.1.40639 XP_019579124.1.88060 XP_019579158.1.88060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]