SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_959018.2.24337 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_959018.2.24337
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 8.89e-21
Family Ribosomal protein L39e 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_959018.2.24337
Sequence length 51
Comment 60S ribosomal protein L39 [Neurospora crassa OR74A]; AA=GCF_000182925.2; RF=representative genome; TAX=367110; STAX=5141; NAME=Neurospora crassa OR74A; strain=OR74A; AL=Chromosome; RT=Major
Sequence
MPSHKTFRVKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGL
Download sequence
Identical sequences A0A0B0DVN7 F7VSB3 F8MKE5 G2QER0 G4UNM2 Q7S2X9
jgi|Neudi1|161566|fgenesh3_kg.5__61__1034_1_CCSY jgi|Spoth1|87961|fgenesh1_kg.4_#_200_#_345_1_CCWO_CCWP_EXTA XP_003663088.1.50100 XP_009851281.1.73169 XP_959018.2.24337 NCU08990T0 jgi|Neute1|113213|estExt_Genewise1Plus.C_30370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]